PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 327aa    MW: 37153.5 Da    PI: 8.0453
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622905.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.7e-55101381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k++++++ ++++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++
  XP_009622905.1  10 LPPGFRFHPTDEELITYYLVNKISDSTNFTARAIGDVDLNKSEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNS 104
                     79************************9777799***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++elvg+kktLvfy+grap+gekt+Wvmheyr+
  XP_009622905.1 105 sTSELVGMKKTLVFYRGRAPRGEKTNWVMHEYRI 138
                     78889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-637160IPR003441NAC domain
PROSITE profilePS5100562.14110160IPR003441NAC domain
PfamPF023651.0E-2811138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEDEVKEETL PPGFRFHPTD EELITYYLVN KISDSTNFTA RAIGDVDLNK SEPWDLPGKA  60
KMGEKEWYFF SLRDRKYPTG VRTNRATNTG YWKTTGKDKE IFNSSTSELV GMKKTLVFYR  120
GRAPRGEKTN WVMHEYRIHS KSSYRTHKQD EWVVCRVFQK SAGGKKYPCN NSRSVNMNPY  180
TLEINPSTMS SQIIQADHIQ GFQLAMGRGY MNHADAEIQE FNRVFRGGSS SSNMSFPVQS  240
QMNYSNLGGG GGNYFTISGL NLNLGSDATT SQPTLRPMLP PQVMNQQDMM TTEAGYGSDM  300
NNSGNTMNRF MAVENCADNL ENYWSPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-56316610171NO APICAL MERISTEM PROTEIN
1ut4_B2e-56316610171NO APICAL MERISTEM PROTEIN
1ut7_A2e-56316610171NO APICAL MERISTEM PROTEIN
1ut7_B2e-56316610171NO APICAL MERISTEM PROTEIN
3swm_A2e-56316613174NAC domain-containing protein 19
3swm_B2e-56316613174NAC domain-containing protein 19
3swm_C2e-56316613174NAC domain-containing protein 19
3swm_D2e-56316613174NAC domain-containing protein 19
3swp_A2e-56316613174NAC domain-containing protein 19
3swp_B2e-56316613174NAC domain-containing protein 19
3swp_C2e-56316613174NAC domain-containing protein 19
3swp_D2e-56316613174NAC domain-containing protein 19
4dul_A2e-56316610171NAC domain-containing protein 19
4dul_B2e-56316610171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622905.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ24e-83NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A068VET31e-166A0A068VET3_COFCA; Uncharacterized protein
STRINGPOPTR_0018s03910.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-114NAC domain containing protein 38